Here's how to stay safe from wildfire smoke amid reduced air quality

1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6, MedicareonFridayreleasednewdetailsabouthowitsnewdrugpricenegotiationprogramwillwork,justtwomonthsbef




fashion

author:knowledge    Page View:1863
A handout illustration representing Google’s DeepMind subsidiary and Isomorphic Labs developed an AI model that can accurately predict how a vast universe of biomolecules interact on an atomic level.
DeepMind

Google on Wednesday unveiled an artificial intelligence tool capable of predicting the structure and interaction of a vast universe of biomolecules, a fundamental advance that may help scientists unravel poorly understood aspects of biology and disease.

The new AI, dubbed AlphaFold 3, improves upon earlier versions of the model by predicting not just the structure of proteins, but all the molecules that interact with them in cells, including RNA, DNA, ions, and other small molecules.

advertisement

Most new drugs consist of small molecules designed to bind to a protein involved in disease. AlphaFold 3 opens broader avenues of exploration, allowing scientists to rapidly examine complex interactions with other molecules that may highlight new disease targets — and different ways of attacking them.

STAT+ Exclusive Story

Already have an account? Log in

STAT+

This article is exclusive to STAT+ subscribers

Unlock this article — and get additional analysis of the technologies disrupting health care — by subscribing to STAT+.

Already have an account? Log in

Already have an account? Log in

Monthly

$39

Totals $468 per year

$39/month Get Started

Totals $468 per year

Starter

$30

for 3 months, then $39/month

$30 for 3 months Get Started

Then $39/month

Annual

$399

Save 15%

$399/year Get Started

Save 15%

11+ Users

Custom

Savings start at 25%!

Request A Quote Request A Quote

Savings start at 25%!

2-10 Users

$300

Annually per user

$300/year Get Started

$300 Annually per user

View All Plans

Get unlimited access to award-winning journalism and exclusive events.

Subscribe Log In