Here's how to stay safe from wildfire smoke amid reduced air quality

1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6, 1:19Ademonstratorrunsonthethirdnightofprotestssparkedbythefatalpoliceshootingofa17-year-olddriverint




leisure time

author:Wikipedia    Page View:71676
Cambridge: Biogen
Ruby Wallau for STAT

Biogen is joining the industry’s fervor over immune and inflammatory disease drug development with a new acquisition.

The Cambridge, Mass., drugmaker announced Wednesday that it will acquire Human Immunology Biosciences, or HI-Bio, for $1.15 billion and up to $650 million in additional payments if certain milestones are met.

advertisement

HI-Bio, which is based in San Francisco, is developing therapies for immune-mediated diseases like primary membranous nephropathy and IgA nephropathy, both of which impact kidney function. The startup’s lead drug, felzartamab, is a monoclonal antibody that selectively depletes CD38+ and natural killer cells in the hopes of alleviating the disease’s effects. It has already completed Phase 2 studies.

STAT+ Exclusive Story

Already have an account? Log in

STAT+

This article is exclusive to STAT+ subscribers

Unlock this article — plus daily coverage and analysis of the biotech sector — by subscribing to STAT+.

Already have an account? Log in

Already have an account? Log in

Monthly

$39

Totals $468 per year

$39/month Get Started

Totals $468 per year

Starter

$30

for 3 months, then $39/month

$30 for 3 months Get Started

Then $39/month

Annual

$399

Save 15%

$399/year Get Started

Save 15%

11+ Users

Custom

Savings start at 25%!

Request A Quote Request A Quote

Savings start at 25%!

2-10 Users

$300

Annually per user

$300/year Get Started

$300 Annually per user

View All Plans

Get unlimited access to award-winning journalism and exclusive events.

Subscribe Log In