Telehealth options flood the market as retailers push virtual care

AdobeWhenpatientsgoshoppingtoday,theymightfindthemselvescheckingoutwithmorethanthevitaminsorbulktoil AnnaMoneymaker/GettyImagesAfterhavingadaytoreadthroughtheSupremeCourt’sdecisiononaffirmativeaction,s




comprehensive

author:knowledge    Page View:8619
Checkpoint inhibitor
Adobe

ITeos Therapeutics offered the first look at clinical data for its experimental cancer antibody that works by blocking the novel — and very buzzworthy — protein target called TIGIT.

The tumor-shrinking activity of the company’s drug, called EOS-448, was minimal but still comparable to early study data from competing TIGIT-targeted drugs in development, including ones from Roche and Merck.

advertisement

iTeos presented the EOS-448 Phase 1 study results at the annual meeting of the American Association for Cancer Research on Saturday.

STAT+ Exclusive Story

Already have an account? Log in

STAT+

This article is exclusive to STAT+ subscribers

Unlock this article — plus daily coverage and analysis of the biotech sector — by subscribing to STAT+.

Already have an account? Log in

Already have an account? Log in

Monthly

$39

Totals $468 per year

$39/month Get Started

Totals $468 per year

Starter

$30

for 3 months, then $39/month

$30 for 3 months Get Started

Then $39/month

Annual

$399

Save 15%

$399/year Get Started

Save 15%

11+ Users

Custom

Savings start at 25%!

Request A Quote Request A Quote

Savings start at 25%!

2-10 Users

$300

Annually per user

$300/year Get Started

$300 Annually per user

View All Plans

Get unlimited access to award-winning journalism and exclusive events.

Subscribe Log In