Here's how to stay safe from wildfire smoke amid reduced air quality

1:54ApersonwearingafacemaskwalksnearaviewofthetheEmpireStateBuildingduringheavysmoginNewYorkonJune6, AnnaMoneymaker/GettyImagesAfterhavingadaytoreadthroughtheSupremeCourt’sdecisiononaffirmativeaction,s




leisure time

author:Wikipedia    Page View:9338
Eli Lilly headquarters in Indianapolis – pharmaceutical coverage from STAT
Darron Cummings/AP

Scientists at the Food and Drug Administration have two big questions about Eli Lilly’s experimental Alzheimer’s drug donanemab ahead of a panel of outside experts that it is convening on Monday:

Should the patients who receive the medicine be limited based on PET scans of a protein called tau that Eli Lilly used as a key criteria for trying to determine whether they should receive the drug? That could reduce usage of the medicine by adding a barrier to its use.

advertisement

And how do the potential risks of using the drug compare to its benefits? The FDA points to one analysis, admittedly with missing data, that could indicate patients who receive the drug have a higher risk of dying.

STAT+ Exclusive Story

Already have an account? Log in

STAT+

This article is exclusive to STAT+ subscribers

Unlock this article — plus daily coverage and analysis of the biotech sector — by subscribing to STAT+.

Already have an account? Log in

Already have an account? Log in

Monthly

$39

Totals $468 per year

$39/month Get Started

Totals $468 per year

Starter

$30

for 3 months, then $39/month

$30 for 3 months Get Started

Then $39/month

Annual

$399

Save 15%

$399/year Get Started

Save 15%

11+ Users

Custom

Savings start at 25%!

Request A Quote Request A Quote

Savings start at 25%!

2-10 Users

$300

Annually per user

$300/year Get Started

$300 Annually per user

View All Plans

Get unlimited access to award-winning journalism and exclusive events.

Subscribe Log In