In areas with more Black doctors, Black people live longer

AdobeBlackpeopleincountieswithmoreBlackprimarycarephysicianslivelonger,accordingtoanewnationalanalys AdobeIn1983,Iflewhomefromcollegetobewithmymotherasshewokeupfromamastectomy.Sheoptedoutofbreastrecons




entertainment

author:Wikipedia    Page View:575
Patrick Hsu, co-founder of the Arc Institute, speaks during the STAT Breakthrough Summit West in San Francisco Thursday. Sarah Gonzalez for STAT

In 2018, during her chemistry Nobel Prize lecture, Frances Arnold noted that scientists had arrived at a point where they could read, write, and edit any sequence of DNA. But composing whole genes or even whole genomes from scratch — that was something only evolution could do.

A few years later, not long after helping to launch the Arc Institute, a nonprofit research center in the Bay Area, molecular engineer Patrick Hsu wondered if it was possible to imitate the forces of evolution that Arnold had been referring to. DNA is a language, after all, and with all the advances in generative AI — chatbots that could hold eerily lifelike conversations if trained on enough text — maybe recreating all the cellular complexity contained in a genome wasn’t that far behind.

advertisement

Working with Brian Hie, a computational biologist at Stanford University and a fellow Arc Institute member, Hsu, who is also an assistant professor at the University of California, Berkeley, began assembling a team of scientists to train an AI model on vast troves of biological data — 300 billion DNA letters, including long sequences from 80,000 genomes of bacteria and archaea.

STAT+ Exclusive Story

Already have an account? Log in

STAT+

This article is exclusive to STAT+ subscribers

Unlock this article — plus in-depth analysis, newsletters, premium events, and networking platform access.

Already have an account? Log in

Already have an account? Log in

Monthly

$39

Totals $468 per year

$39/month Get Started

Totals $468 per year

Starter

$30

for 3 months, then $39/month

$30 for 3 months Get Started

Then $39/month

Annual

$399

Save 15%

$399/year Get Started

Save 15%

11+ Users

Custom

Savings start at 25%!

Request A Quote Request A Quote

Savings start at 25%!

2-10 Users

$300

Annually per user

$300/year Get Started

$300 Annually per user

View All Plans

Get unlimited access to award-winning journalism and exclusive events.

Subscribe Log In